SAV1 Antibody

Images

 
Orthogonal Strategies: Western Blot: SAV1 Antibody [NBP2-13282] - Analysis in human cell lines U2OS and A-549 using anti-SAV1 antibody. Corresponding SAV1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: SAV1 Antibody [NBP2-13282] - Immunofluorescent staining of human cell line SiHa shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SAV1 Antibody [NBP2-13282] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: SAV1 Antibody [NBP2-13282] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SAV1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGRVAATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSH PLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPV TYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQL
Specificity
Specificity of human SAV1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAV1 Protein (NBP2-13282PEP)
Publications
Read Publication using
NBP2-13282 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAV1 Antibody

  • 45 kDa WW domain protein
  • hWW45
  • protein salvador homolog 1
  • salvador homolog 1 (Drosophila)
  • SAV
  • WW domain-containing
  • WW45salvador
  • WWP4,1700040G09Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB200-197
Species: Hu, Mu
Applications: WB, IP
NBP1-82865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-66121
Species: Hu
MAB7940
Species: Hu
Applications: WB, IHC
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67837
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-199
Species: Hu, Mu
Applications: WB, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5066
Species: Hu
Applications: WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for SAV1 Antibody (NBP2-13282)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SAV1 Antibody (NBP2-13282) (0)

There are no reviews for SAV1 Antibody (NBP2-13282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAV1 Antibody (NBP2-13282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SAV1 Antibody (NBP2-13282)

Discover related pathways, diseases and genes to SAV1 Antibody (NBP2-13282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAV1 Antibody (NBP2-13282)

Discover more about diseases related to SAV1 Antibody (NBP2-13282).
 

Pathways for SAV1 Antibody (NBP2-13282)

View related products by pathway.

PTMs for SAV1 Antibody (NBP2-13282)

Learn more about PTMs related to SAV1 Antibody (NBP2-13282).

Blogs on SAV1

There are no specific blogs for SAV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAV1