SASS6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SASS6 Antibody [NBP1-85043] - Staining of human cell line U-251 MG shows localization to cytosol & microtubule organizing center.
Immunohistochemistry: SASS6 Antibody [NBP1-85043] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SASS6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNENQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SASS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SASS6 Protein (NBP1-85043PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SASS6 Antibody

  • DKFZp761A078
  • FLJ22097
  • HsSAS-6
  • MGC119440
  • SAS-6
  • SAS6hsSAS-6
  • spindle assembly 6 homolog (C. elegans)
  • spindle assembly abnormal protein 6 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-58439
Species: Hu
Applications: WB, ICC/IF
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91892
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28718
Species: Hu
Applications: WB, IP
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-89098
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00005670-T01
Species: Hu
AF4478
Species: Hu
Applications: WB, IHC
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for SASS6 Antibody (NBP1-85043) (0)

There are no publications for SASS6 Antibody (NBP1-85043).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SASS6 Antibody (NBP1-85043) (0)

There are no reviews for SASS6 Antibody (NBP1-85043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SASS6 Antibody (NBP1-85043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SASS6 Products

Bioinformatics Tool for SASS6 Antibody (NBP1-85043)

Discover related pathways, diseases and genes to SASS6 Antibody (NBP1-85043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SASS6 Antibody (NBP1-85043)

Discover more about diseases related to SASS6 Antibody (NBP1-85043).
 

Pathways for SASS6 Antibody (NBP1-85043)

View related products by pathway.

PTMs for SASS6 Antibody (NBP1-85043)

Learn more about PTMs related to SASS6 Antibody (NBP1-85043).
 

Research Areas for SASS6 Antibody (NBP1-85043)

Find related products by research area.

Blogs on SASS6

There are no specific blogs for SASS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SASS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SASS6