CEP152 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CEP152 Antibody [NBP1-82953] - Staining of human cell line U-2 OS shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP152 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP152
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Control Peptide
CEP152 Protein (NBP1-82953PEP)
Publications
Read Publications using
NBP1-82953 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23761850)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP152 Antibody

  • centrosomal protein 152kDa
  • centrosomal protein of 152 kDa
  • Cep152
  • FLJ21594
  • KIAA0912MCPH4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEP152 Antibody (NBP1-82953)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CEP152 Antibody (NBP1-82953) (0)

There are no reviews for CEP152 Antibody (NBP1-82953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CEP152 Antibody (NBP1-82953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP152 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP152