CEP135 Antibody

Western Blot: CEP135 Antibody [NBP3-10683] - Western blot analysis of CEP135 in A549 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CEP135 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP135 (NP_079285). Peptide sequence REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP135
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 133 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for CEP135 Antibody

• centrosomal protein 135kDa
• Centrosomal protein 4centrosomal protein of 135 kDa
• Cep135
• CEP4
• FLJ13621
• KIAA0635centrosome protein cep135

Background

Centrosomal protein of 135kDa (CEP135) is a coiled-coil centrosome protein that plays a role in centriole-centriole cohesion. As part of the centrosome, CEP135 is critical to the assembly and maintenance of functional microtubule-organizing centers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEP135