SASH1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SASH1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SASH1.
  
  

  Source: E. coli

  Amino Acid Sequence: LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SASH1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85183.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SASH1 Recombinant Protein Antigen

• dJ323M4
• dJ323M4.1
• KIAA0790RP3-323M4.1
• PEPE1
• Proline-glutamate repeat-containing protein
• SAM and SH3 domain containing 1,2500002E12Rik
• SAM and SH3 domain-containing protein 1
• SH3D6A

Background

SASH1 (SAM and SH3 domain containing 1) was identified in an in silico analysis of loss of heterozygosity (LOH) to identify genes downregulated in breast cancer. Since this discovery, it has also been found to be a candidate tumor suppressor in colon cancer. Structurally, SASH1 contains two SAM (sterile alpha motif) domains and one SH3 domain indicating a role in signal transduction and as a signaling adapter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SASH1