Sarcoma Antigen NY-SAR-27 Antibody

Images

 
Western Blot: Sarcoma Antigen NY-SAR-27 Antibody [NBP2-30709] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunohistochemistry: Sarcoma Antigen NY-SAR-27 Antibody [NBP2-30709] - Staining of human tonsil shows strong cytoplasmic positivity in a subset of germinal and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sarcoma Antigen NY-SAR-27 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQQQCDGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPF38B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sarcoma Antigen NY-SAR-27 Antibody

  • NET1
  • Pre-MRNA Processing Factor 38B
  • Pre-MRNA-Splicing Factor 38B
  • PRP38 Pre-MRNA Processing Factor 38 (Yeast) Domain Containing B
  • PRPF38B
  • RP11-293A10.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001815-R02
Species: Hu
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF6820
Species: Mu, Rt
Applications: WB, IHC
NBP1-76645
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30709
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709) (0)

There are no publications for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709) (0)

There are no reviews for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sarcoma Antigen NY-SAR-27 Products

Bioinformatics Tool for Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709)

Discover related pathways, diseases and genes to Sarcoma Antigen NY-SAR-27 Antibody (NBP2-30709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Sarcoma Antigen NY-SAR-27

There are no specific blogs for Sarcoma Antigen NY-SAR-27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sarcoma Antigen NY-SAR-27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF38B
Uniprot