We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SAR1B Recombinant Protein Antigen

Images

 
There are currently no images for SAR1B Protein (NBP2-33521PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAR1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAR1B.

Source: E. coli

Amino Acid Sequence: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAR1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33521.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAR1B Recombinant Protein Antigen

  • 2310075M17Rik
  • ANDD
  • CMRD
  • EC 3.6.5
  • GTP-binding protein B
  • GTP-binding protein SAR1b
  • GTP-binding protein Sara
  • SAR1 homolog B (S. cerevisiae)
  • SAR1a gene homolog (S. cerevisiae) 2
  • SAR1a gene homolog 2 (S. cerevisiae)
  • SAR1a gene homolog 2
  • SARA2GTBPB
  • SARB

Background

SAR1B belongs to the small GTPase superfamily, SAR1 family. It is involved in transport from the endoplasmic reticulum to the Golgi apparatus and is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex. Defects in SAR1B are the cause of chylomicron retention disease (CMRD). CMRD is an autosomal recessive disorder of severe fat malabsorption associated with failure to thrive in infancy. The conditions are characterized by deficiency of fat-soluble vitamins, low blood cholesterol levels, and a selective absence of chylomicrons from blood. Affected individuals accumulate chylomicron-like particles in membrane-bound compartments of enterocytes, which contain large cytosolic lipid droplets.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80789
Species: Hu
Applications: IHC,  IHC-P, KD, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP1-82456
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-22552
Species: Hu
Applications: IHC, WB
PP-H4417-00
Applications: DirELISA, IP, WB
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP2-34842
Species: Ha, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NBP1-88713
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-33521PEP
Species: Hu
Applications: AC

Publications for SAR1B Protein (NBP2-33521PEP) (0)

There are no publications for SAR1B Protein (NBP2-33521PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAR1B Protein (NBP2-33521PEP) (0)

There are no reviews for SAR1B Protein (NBP2-33521PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAR1B Protein (NBP2-33521PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAR1B Products

Research Areas for SAR1B Protein (NBP2-33521PEP)

Find related products by research area.

Blogs on SAR1B

There are no specific blogs for SAR1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAR1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAR1B