SAPS1 Antibody

Images

 
Western Blot: SAPS1 Antibody [NBP1-57815] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAPS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Canine (93%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP6R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SAPS1 and was validated on Western blot.
Control
SAPS1 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SAPS1 Antibody

  • KIAA1115MGC138185
  • PP6R1MGC142003
  • protein phosphatase 6, regulatory subunit 1
  • SAP190
  • SAPS domain family member 1
  • SAPS domain family, member 1
  • SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1

Background

Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13804
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80898
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-88014
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008518-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-24503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-02456
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P, IP
AF4300
Species: Hu
Applications: IHC
NBP1-50579
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Pm, Pm, Rb, Sh, Xp, Ze
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-98486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81176
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-57815
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for SAPS1 Antibody (NBP1-57815) (0)

There are no publications for SAPS1 Antibody (NBP1-57815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAPS1 Antibody (NBP1-57815) (0)

There are no reviews for SAPS1 Antibody (NBP1-57815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAPS1 Antibody (NBP1-57815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SAPS1 Products

Array NBP1-57815

Bioinformatics Tool for SAPS1 Antibody (NBP1-57815)

Discover related pathways, diseases and genes to SAPS1 Antibody (NBP1-57815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SAPS1

There are no specific blogs for SAPS1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP6R1