SAPS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SAPS2 Antibody [NBP1-88014] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: SAPS2 Antibody [NBP1-88014] - Staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAPS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLLASFFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP6R2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAPS2 Protein (NBP1-88014PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAPS2 Antibody

  • dJ579N16.1
  • KIAA0685PP6R2SAPS2serine/threonine-protein phosphatase 6 regulatory subunit 2
  • protein phosphatase 6, regulatory subunit 2
  • SAP190
  • SAPS domain family member 2
  • SAPS domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP2-34049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-48803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2883
Species: Hu, Mu
Applications: WB, IP
NBP1-80898
Species: Hu
Applications: WB, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
AF4300
Species: Hu
Applications: IHC
NBP1-81176
Species: Hu
Applications: WB, IHC, IHC-P
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB5074
Species: Hu
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SAPS2 Antibody (NBP1-88014) (0)

There are no publications for SAPS2 Antibody (NBP1-88014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAPS2 Antibody (NBP1-88014) (0)

There are no reviews for SAPS2 Antibody (NBP1-88014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAPS2 Antibody (NBP1-88014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAPS2 Products

Bioinformatics Tool for SAPS2 Antibody (NBP1-88014)

Discover related pathways, diseases and genes to SAPS2 Antibody (NBP1-88014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SAPS2

There are no specific blogs for SAPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAPS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP6R2