TMEM115 Antibody

Images

 
Western Blot: TMEM115 Antibody [NBP1-80898] - Analysis in control (vector only transfected HEK293T lysate) and tMEM115 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TMEM115 Antibody [NBP1-80898] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM115 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM115
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM115 Protein (NBP1-80898PEP)
Publications
Read Publication using
NBP1-80898 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Human reactivity reported in scientific literature (PMID: 24806965).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM115 Antibody

  • PL6Placental protein 6
  • PP6
  • Protein PL6
  • transmembrane protein 115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5074
Species: Hu
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-87239
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88014
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80898
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for TMEM115 Antibody (NBP1-80898)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM115 Antibody (NBP1-80898) (0)

There are no reviews for TMEM115 Antibody (NBP1-80898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM115 Antibody (NBP1-80898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM115 Products

Bioinformatics Tool for TMEM115 Antibody (NBP1-80898)

Discover related pathways, diseases and genes to TMEM115 Antibody (NBP1-80898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM115 Antibody (NBP1-80898)

Discover more about diseases related to TMEM115 Antibody (NBP1-80898).
 

Pathways for TMEM115 Antibody (NBP1-80898)

View related products by pathway.

PTMs for TMEM115 Antibody (NBP1-80898)

Learn more about PTMs related to TMEM115 Antibody (NBP1-80898).

Blogs on TMEM115

There are no specific blogs for TMEM115, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM115 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM115