We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SAP30BP Recombinant Protein Antigen

Images

 
There are currently no images for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAP30BP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAP30BP

Source: E.coli

Amino Acid Sequence: SEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAP30BP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83278. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAP30BP Recombinant Protein Antigen

  • HCNGPDKFZp586L2022
  • HTRGHSV-1 binding
  • HTRPSAP30-binding protein
  • SAP30 binding protein
  • Transcriptional regulator protein HCNGP

Background

SAP30BP, also known as SAP30-binding protein, has a 308 amino acid long isoform that is 34 kDa and a short 292 amino acid isoform that is 32 kDa; is involved in the regulation of beta-2-microglobulin genes and also plays a role of a transcriptional co-repressor of a gene related to cell survival. Studies on this protein have shown its involvement with obesity and schizophrenia. This protein has been shown to have interactions with PUF60, SF3A2, MLX, SAP30, FHL2, ZNF212, ZNF408, and MEPCE protein in transcription, DNA-dependent; regulation of transcription DNA-dependent, apoptotic process, and induction of apoptosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008819-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MPTX20
Species: Mu
Applications: ELISA
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-92131
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
7027-GT
Species: Hu, Wf
Applications: EnzAct
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-83278PEP
Species: Hu
Applications: AC

Publications for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP) (0)

There are no publications for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP) (0)

There are no reviews for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAP30BP Recombinant Protein Antigen (NBP1-83278PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAP30BP Products

Blogs on SAP30BP

There are no specific blogs for SAP30BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAP30BP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30BP