SAP30BP Recombinant Protein Antigen

Images

 
There are currently no images for SAP30BP Protein (NBP2-38685PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAP30BP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAP30BP.

Source: E. coli

Amino Acid Sequence: QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAP30BP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38685.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SAP30BP Recombinant Protein Antigen

  • HCNGPDKFZp586L2022
  • HTRGHSV-1 binding
  • HTRPSAP30-binding protein
  • SAP30 binding protein
  • Transcriptional regulator protein HCNGP

Background

SAP30BP, also known as SAP30-binding protein, has a 308 amino acid long isoform that is 34 kDa and a short 292 amino acid isoform that is 32 kDa; is involved in the regulation of beta-2-microglobulin genes and also plays a role of a transcriptional co-repressor of a gene related to cell survival. Studies on this protein have shown its involvement with obesity and schizophrenia. This protein has been shown to have interactions with PUF60, SF3A2, MLX, SAP30, FHL2, ZNF212, ZNF408, and MEPCE protein in transcription, DNA-dependent; regulation of transcription DNA-dependent, apoptotic process, and induction of apoptosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008819-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-92131
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
7027-GT
Species: Hu
Applications: EnzAct
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-38685PEP
Species: Hu
Applications: AC

Publications for SAP30BP Protein (NBP2-38685PEP) (0)

There are no publications for SAP30BP Protein (NBP2-38685PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30BP Protein (NBP2-38685PEP) (0)

There are no reviews for SAP30BP Protein (NBP2-38685PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAP30BP Protein (NBP2-38685PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAP30BP Products

Bioinformatics Tool for SAP30BP Protein (NBP2-38685PEP)

Discover related pathways, diseases and genes to SAP30BP Protein (NBP2-38685PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP30BP Protein (NBP2-38685PEP)

Discover more about diseases related to SAP30BP Protein (NBP2-38685PEP).
 

Pathways for SAP30BP Protein (NBP2-38685PEP)

View related products by pathway.

PTMs for SAP30BP Protein (NBP2-38685PEP)

Learn more about PTMs related to SAP30BP Protein (NBP2-38685PEP).

Blogs on SAP30BP

There are no specific blogs for SAP30BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAP30BP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30BP