SAP130 Recombinant Protein Antigen

Images

 
There are currently no images for SAP130 Recombinant Protein Antigen (NBP2-58943PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAP130 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAP130.

Source: E. coli

Amino Acid Sequence: ETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3B3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58943.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAP130 Recombinant Protein Antigen

  • KIAA0017splicing factor 3b, subunit 3, 130kD
  • Pre-mRNA-splicing factor SF3b 130 kDa subunit
  • RSE1
  • SAP130SAP 130
  • SF3B130
  • SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit
  • Spliceosome-associated protein 130
  • splicing factor 3B subunit 3
  • splicing factor 3b, subunit 3, 130kDa
  • STAF130

Background

SAP130 encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-92692
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-75465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF3297
Species: Hu
Applications: WB
NBP2-49303
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP3-45301
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-49311
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for SAP130 Recombinant Protein Antigen (NBP2-58943PEP) (0)

There are no publications for SAP130 Recombinant Protein Antigen (NBP2-58943PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP130 Recombinant Protein Antigen (NBP2-58943PEP) (0)

There are no reviews for SAP130 Recombinant Protein Antigen (NBP2-58943PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAP130 Recombinant Protein Antigen (NBP2-58943PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAP130 Products

Blogs on SAP130

There are no specific blogs for SAP130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SAP130 Antibody
NB100-1077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAP130 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B3