SAP130 Antibody (2F1)

Images

 
Immunocytochemistry/ Immunofluorescence: SAP130 Antibody (2F1) [H00023450-M03] - Immunofluorescence of monoclonal antibody to SAP130 on HeLa cell. [antibody concentration 40 ug/ml]
Immunocytochemistry/ Immunofluorescence: SAP130 Antibody (2F1) [H00023450-M03] - Analysis of monoclonal antibody to SF3B3 on HeLa cell. Antibody concentration 40 ug/ml
Sandwich ELISA: SAP130 Antibody (2F1) [H00023450-M03] - Detection limit for recombinant GST tagged SF3B3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, S-ELISA
Clone
2F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SAP130 Antibody (2F1) Summary

Immunogen
SF3B3 (NP_036558.3, 819 a.a. ~ 929 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK
Specificity
SF3B3 - splicing factor 3b, subunit 3, 130kDa (2F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SF3B3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAP130 Antibody (2F1)

  • KIAA0017splicing factor 3b, subunit 3, 130kD
  • Pre-mRNA-splicing factor SF3b 130 kDa subunit
  • RSE1
  • SAP130SAP 130
  • SF3B130
  • SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit
  • Spliceosome-associated protein 130
  • splicing factor 3B subunit 3
  • splicing factor 3b, subunit 3, 130kDa
  • STAF130

Background

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NB100-79848
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-92692
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-33061
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3297
Species: Hu
Applications: WB
NBP2-49303
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00117143-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-49311
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for SAP130 Antibody (H00023450-M03) (0)

There are no publications for SAP130 Antibody (H00023450-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP130 Antibody (H00023450-M03) (0)

There are no reviews for SAP130 Antibody (H00023450-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAP130 Antibody (H00023450-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAP130 Products

Bioinformatics Tool for SAP130 Antibody (H00023450-M03)

Discover related pathways, diseases and genes to SAP130 Antibody (H00023450-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP130 Antibody (H00023450-M03)

Discover more about diseases related to SAP130 Antibody (H00023450-M03).
 

Pathways for SAP130 Antibody (H00023450-M03)

View related products by pathway.

PTMs for SAP130 Antibody (H00023450-M03)

Learn more about PTMs related to SAP130 Antibody (H00023450-M03).

Blogs on SAP130

There are no specific blogs for SAP130, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP130 Antibody (2F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B3
Entrez
Uniprot