S100P Antibody (4E7.)

Images

 
Immunocytochemistry/ Immunofluorescence: S100P Antibody (4E7) [H00006286-M02] - Analysis of monoclonal antibody to S100P on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: S100P Antibody (4E7) [H00006286-M02] - Detection limit for recombinant GST tagged S100P is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100P Antibody (4E7.) Summary

Immunogen
S100P (AAH06819, 1 a.a. - 95 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Specificity
S100P - S100 calcium binding protein P (4E7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100P
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100P Antibody (4E7.)

  • MIG9
  • migration-inducing gene 9
  • Protein S100-E
  • S100 calcium binding protein P
  • S100 calcium-binding protein Pprotein S100-P
  • S100E
  • S100P

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-48581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00006286-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for S100P Antibody (H00006286-M02) (0)

There are no publications for S100P Antibody (H00006286-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100P Antibody (H00006286-M02) (0)

There are no reviews for S100P Antibody (H00006286-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100P Antibody (H00006286-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100P Products

Bioinformatics Tool for S100P Antibody (H00006286-M02)

Discover related pathways, diseases and genes to S100P Antibody (H00006286-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100P Antibody (H00006286-M02)

Discover more about diseases related to S100P Antibody (H00006286-M02).
 

Pathways for S100P Antibody (H00006286-M02)

View related products by pathway.

PTMs for S100P Antibody (H00006286-M02)

Learn more about PTMs related to S100P Antibody (H00006286-M02).

Blogs on S100P

There are no specific blogs for S100P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100P Antibody (4E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100P
Entrez
Uniprot