S100P Antibody (4E7)

Immunocytochemistry/Immunofluorescence: S100P Antibody (4E7) [H00006286-M02] - Analysis of monoclonal antibody to S100P on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: S100P Antibody (4E7) [H00006286-M02] - Detection limit for recombinant GST tagged S100P is approximately 3ng/ml as a capture antibody.

Product Discontinued

S100P Antibody (4E7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
• Specificity: S100P - S100 calcium binding protein P (4E7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: S100P
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100P Antibody (4E7)

• MIG9
• migration-inducing gene 9
• Protein S100-E
• S100 calcium binding protein P
• S100 calcium-binding protein Pprotein S100-P
• S100E
• S100P

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100P
• Entrez:
  • 6286(Human)
• Uniprot:
  • AAH06819(Human)