S100G Antibody

Images

 
Immunohistochemistry: S100G Antibody [NBP2-31615] - Staining of human small intestine shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100G Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
S100G Recombinant Protein Antigen (NBP2-31615PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100G Antibody

  • CABP
  • CABP1
  • CaBP9K
  • CABP9KMGC138379
  • CALB3calbindin D9K
  • calbindin 3, (vitamin D-dependent calcium-binding protein)
  • calbindin-D9K
  • protein S100-G
  • S100 calcium binding protein G
  • S100 calcium-binding protein G
  • S100D
  • Vitamin D-dependent calcium-binding protein, intestinal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-35213
Species: Hu
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-31615
Species: Hu
Applications: IHC, IHC-P

Publications for S100G Antibody (NBP2-31615) (0)

There are no publications for S100G Antibody (NBP2-31615).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100G Antibody (NBP2-31615) (0)

There are no reviews for S100G Antibody (NBP2-31615). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S100G Antibody (NBP2-31615) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100G Products

Bioinformatics Tool for S100G Antibody (NBP2-31615)

Discover related pathways, diseases and genes to S100G Antibody (NBP2-31615). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100G Antibody (NBP2-31615)

Discover more about diseases related to S100G Antibody (NBP2-31615).
 

Pathways for S100G Antibody (NBP2-31615)

View related products by pathway.

PTMs for S100G Antibody (NBP2-31615)

Learn more about PTMs related to S100G Antibody (NBP2-31615).

Blogs on S100G

There are no specific blogs for S100G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100G
Uniprot