S100A4 Antibody - BSA Free

Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Analysis in human lymph node and cerebral cortex tissues using NBP1-89402 antibody. Corresponding S100A4 RNA-seq data are presented for the same tissues.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-S100A4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt, Po
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 26056290)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  S100A4 Protein (NBP1-89402PEP)

Reactivity Notes

Porcine reactivity reported in the scientific literature (PMID: 26379359).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A4 Antibody - BSA Free

• 18A2
• 42A
• Calvasculin
• CAPL
• CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin
• fibroblast-specific protein-1,42A
• FSP1
• leukemia multidrug resistance associated protein
• malignant transformation suppression 1
• Metastasin
• MTS1
• murine placental homolog)
• P9KA
• PEL98
• Placental calcium-binding protein
• Protein Mts1
• protein S100-A4
• S100 calcium binding protein A4
• S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
• S100 calcium-binding protein A4
• S100A4

Background

S100A4 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A4 Antibody (NBP1-89402)(4)

Publications using NBP1-89402

• Ardalani H, Sengupta S, Harms V et al. 3-D Culture and Endothelial Cells Improve Maturity of Human Pluripotent Stem Cell-Derived Hepatocytes Acta Biomater 2019-07-27 [PMID: 31362140] (ICC/IF, Human)
• Rocchiccioli Silvia, Cecchettini Antonella, Ucciferri Nadia et al. Site-Specific Secretome Map Evidences VSMC-Related Markers of Coronary Atherosclerosis Grade and Extent in the Hypercholesterolemic Swine. Dis Markers 2015-01-01 [PMID: 26379359] (IF/IHC, Porcine)
• den Boon JA, Pyeon D, Wang SS et al. Molecular transitions from papillomavirus infection to cervical precancer and cancer: Role of stromal estrogen receptor signaling. Proc Natl Acad Sci U S A 2015-06-23 [PMID: 26056290] (IF/IHC, ICC/IF, Human)
• Lague MN, Detmar J, Paquet M et al. Decidual PTEN expression is required for trophoblast invasion in the mouse. Am J Physiol Endocrinol Metab 2010-12-01 [PMID: 20858757]

Bioinformatics

• Gene Symbol: S100A4
• Entrez:
  • 6275(Human)
• Uniprot:
  • P26447()