Orthogonal Strategies: Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Analysis in human lymph node and cerebral cortex tissues using NBP1-89402 antibody. Corresponding S100A4 RNA-seq data are ...read more
Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: S100A4 Antibody [NBP1-89402] - Staining of human liver shows no positivity in hepatocytes as expected.
Genetic Strategies: Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-S100A4 antibody. Remaining relative intensity is presented. Loading control: ...read more
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Novus Biologicals Rabbit S100A4 Antibody - BSA Free (NBP1-89402) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-S100A4 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 26056290)
Immunohistochemistry 1:1000 - 1:2500
Immunohistochemistry-Paraffin 1:1000 - 1:2500
Knockdown Validated
Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
12 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
S100A4 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our S100A4 Antibody - BSA Free and receive a gift card or discount.