S100A11 Antibody - BSA Free

Western Blot: S100A11 Antibody [NBP3-03232] - Analysis of extracts of various cell lines, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Immunocytochemistry/Immunofluorescence: S100A11 Antibody [NBP3-03232] - Analysis of U2OS cells using S100A11 antibody . Blue: DAPI for nuclear staining.

Western Blot: S100A11 Antibody [NBP3-03232] - Analysis of extracts from normal (control) and S100A11 knockout (KO) HeLa cells, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunoprecipitation: S100A11 Antibody [NBP3-03232] - Immunoprecipitation analysis of 200ug extracts of THP-1 cells using 3ug S100A11 antibody (NBP3-03232). Western blot was performed from the immunoprecipitate using S100A11 antibody (NBP3-03232) at a dilution of 1:1000.

• Reactivity: Hu
• Applications: WB, ICC/IF, IP, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A11 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit S100A11 Antibody - BSA Free (NBP3-03232) is a polyclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S100A11 Antibody - BSA Free

• Calgizzarin
• Metastatic lymph node gene 70 protein
• MLN 70
• MLN70
• protein S100-A11
• Protein S100-C
• S100 calcium binding protein A11
• S100 calcium-binding protein A11 (calgizzarin)
• S100 calcium-binding protein A11
• S100A11
• S100C
• S100CS100 calcium binding protein A11 (calgizzarin)

Background

S100A11 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A11