S100A11 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSF |
| Predicted Species |
Mouse (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
S100A11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for S100A11 Antibody - BSA Free
Background
S100A11 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: EM, Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC
Publications for S100A11 Antibody (NBP2-13270) (0)
There are no publications for S100A11 Antibody (NBP2-13270).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for S100A11 Antibody (NBP2-13270) (0)
There are no reviews for S100A11 Antibody (NBP2-13270).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for S100A11 Antibody (NBP2-13270) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional S100A11 Products
Research Areas for S100A11 Antibody (NBP2-13270)
Find related products by research area.
|
Blogs on S100A11