S100A11 Antibody - BSA Free

Immunohistochemistry-Paraffin: S100A11 Antibody [NBP2-13270] - Staining in human esophagus and cerebral cortex tissues using anti-S100A11 antibody. Corresponding S100A11 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: S100A11 Antibody [NBP2-13270] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: S100A11 Antibody [NBP2-13270] - Staining of human esophagus shows high expression.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100A11 Antibody - BSA Free (NBP2-13270) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSF
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  S100A11 Protein (NBP2-13270PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A11 Antibody - BSA Free

• Calgizzarin
• Metastatic lymph node gene 70 protein
• MLN 70
• MLN70
• protein S100-A11
• Protein S100-C
• S100 calcium binding protein A11
• S100 calcium-binding protein A11 (calgizzarin)
• S100 calcium-binding protein A11
• S100A11
• S100C
• S100CS100 calcium binding protein A11 (calgizzarin)

Background

S100A11 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A11