S100A11 Antibody

Images

 
Immunohistochemistry-Paraffin: S100A11 Antibody [NBP2-13270] - Staining of human urinary bladder shows strong nuclear and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100A11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMK KLDTNSDGQLDFSEFLNLIGGLAMACHDSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
S100A11 Protein (NBP2-13270PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100A11 Antibody

  • Calgizzarin
  • Metastatic lymph node gene 70 protein
  • MLN 70
  • MLN70
  • protein S100-A11
  • Protein S100-C
  • S100 calcium binding protein A11
  • S100 calcium-binding protein A11 (calgizzarin)
  • S100 calcium-binding protein A11
  • S100A11
  • S100C
  • S100CS100 calcium binding protein A11 (calgizzarin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF4870
Species: Hu
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-13270
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for S100A11 Antibody (NBP2-13270) (0)

There are no publications for S100A11 Antibody (NBP2-13270).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A11 Antibody (NBP2-13270) (0)

There are no reviews for S100A11 Antibody (NBP2-13270). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for S100A11 Antibody (NBP2-13270) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A11 Products

Bioinformatics Tool for S100A11 Antibody (NBP2-13270)

Discover related pathways, diseases and genes to S100A11 Antibody (NBP2-13270). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A11 Antibody (NBP2-13270)

Discover more about diseases related to S100A11 Antibody (NBP2-13270).
 

Pathways for S100A11 Antibody (NBP2-13270)

View related products by pathway.

PTMs for S100A11 Antibody (NBP2-13270)

Learn more about PTMs related to S100A11 Antibody (NBP2-13270).
 

Research Areas for S100A11 Antibody (NBP2-13270)

Find related products by research area.

Blogs on S100A11

There are no specific blogs for S100A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A11
Entrez