RXR gamma/NR2B3 Antibody (6H1) - Azide and BSA Free

Western Blot: RXR gamma/NR2B3 Antibody (6H1) [H00006258-M01] - Analysis of RXRG expression in transfected 293T cell line by RXRG monoclonal antibody (M01), clone 6H1.Lane 1: RXRG transfected lysate(50.871 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: RXR gamma/NR2B3 Antibody (6H1) [H00006258-M01] - Detection limit for recombinant GST tagged RXRG is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6H1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RXR gamma/NR2B3 Antibody (6H1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RXRG (NP_008848, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS
• Localization: Nuclear
• Specificity: RXRG - retinoid X receptor, gamma
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RXRG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RXR gamma/NR2B3 Antibody (6H1) - Azide and BSA Free

• NR2B3
• NR2B3retinoid X receptor-gamma
• Nuclear receptor subfamily 2 group B member 3
• retinoic acid receptor RXR-gamma
• Retinoid X receptor gamma
• retinoid X receptor, gamma
• RXR gamma
• RXRC
• RXRG

Background

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RXRG
• Entrez:
  • 6258(Human)
• OMIM:
  • 180247(Human)
• Uniprot:
  • NP_008848(Human)