RXR gamma/NR2B3 Antibody (6H1)


Western Blot: RXR gamma/NR2B3 Antibody (6H1) [H00006258-M01] - Analysis of RXRG expression in transfected 293T cell line by RXRG monoclonal antibody (M01), clone 6H1.Lane 1: RXRG transfected lysate(50.871 KDa).Lane 2: ...read more
Sandwich ELISA: RXR gamma/NR2B3 Antibody (6H1) [H00006258-M01] - Detection limit for recombinant GST tagged RXRG is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

RXR gamma/NR2B3 Antibody (6H1) Summary

RXRG (NP_008848, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS
RXRG - retinoid X receptor, gamma
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RXR gamma/NR2B3 Antibody (6H1)

  • NR2B3
  • NR2B3retinoid X receptor-gamma
  • Nuclear receptor subfamily 2 group B member 3
  • retinoic acid receptor RXR-gamma
  • Retinoid X receptor gamma
  • retinoid X receptor, gamma
  • RXR gamma
  • RXRC
  • RXRG


This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP, GS
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Mu
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for RXR gamma/NR2B3 Antibody (H00006258-M01) (0)

There are no publications for RXR gamma/NR2B3 Antibody (H00006258-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RXR gamma/NR2B3 Antibody (H00006258-M01) (0)

There are no reviews for RXR gamma/NR2B3 Antibody (H00006258-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RXR gamma/NR2B3 Antibody (H00006258-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RXR gamma/NR2B3 Products

Bioinformatics Tool for RXR gamma/NR2B3 Antibody (H00006258-M01)

Discover related pathways, diseases and genes to RXR gamma/NR2B3 Antibody (H00006258-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RXR gamma/NR2B3 Antibody (H00006258-M01)

Discover more about diseases related to RXR gamma/NR2B3 Antibody (H00006258-M01).

Pathways for RXR gamma/NR2B3 Antibody (H00006258-M01)

View related products by pathway.

PTMs for RXR gamma/NR2B3 Antibody (H00006258-M01)

Learn more about PTMs related to RXR gamma/NR2B3 Antibody (H00006258-M01).

Research Areas for RXR gamma/NR2B3 Antibody (H00006258-M01)

Find related products by research area.

Blogs on RXR gamma/NR2B3

There are no specific blogs for RXR gamma/NR2B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RXR gamma/NR2B3 Antibody (6H1) and receive a gift card or discount.


Gene Symbol RXRG