RUVBL2 Antibody


Western Blot: RUVBL2 Antibody [NBP2-57593] - Analysis using Anti-RUVBL2 antibody NBP2-57593 (A) shows similar pattern to independent antibody NBP2-55231 (B).
Immunocytochemistry/ Immunofluorescence: RUVBL2 Antibody [NBP2-57593] - Staining of human cell line A549 shows localization to nucleoplasm, cytosol & centrosome.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUVBL2 Antibody [NBP2-57593] - Staining in human testis and liver tissues using anti-RUVBL2 antibody. Corresponding RUVBL2 RNA-seq data are presented for the more
Immunohistochemistry-Paraffin: RUVBL2 Antibody [NBP2-57593] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: RUVBL2 Antibody [NBP2-57593] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

RUVBL2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Specificity of human RUVBL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUVBL2 Recombinant Protein Antigen (NBP2-57593PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RUVBL2 Antibody

  • 48 kDa TATA box-binding protein-interacting protein
  • 51 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC,48 kDa TBP-interacting protein
  • ECP51TIP49B
  • erythrocyte cytosolic protein, 51-KD
  • INO80 complex subunit J
  • INO80JTAP54-beta
  • Repressing pontin 52
  • Reptin 52
  • Reptin52
  • RuvB (E coli homolog)-like 2
  • RuvB-like 2 (E. coli)
  • ruvB-like 2
  • RVB2
  • TBP-interacting protein, 48-KD
  • TIH2
  • TIP48ECP-51
  • TIP49b
  • TIP60-associated protein 54-beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
Species: Hu
Applications: WB (-), IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: PEP-ELISA
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RUVBL2 Antibody (NBP2-57593) (0)

There are no publications for RUVBL2 Antibody (NBP2-57593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUVBL2 Antibody (NBP2-57593) (0)

There are no reviews for RUVBL2 Antibody (NBP2-57593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUVBL2 Antibody (NBP2-57593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RUVBL2 Antibody (NBP2-57593)

Discover related pathways, diseases and genes to RUVBL2 Antibody (NBP2-57593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUVBL2 Antibody (NBP2-57593)

Discover more about diseases related to RUVBL2 Antibody (NBP2-57593).

Pathways for RUVBL2 Antibody (NBP2-57593)

View related products by pathway.

PTMs for RUVBL2 Antibody (NBP2-57593)

Learn more about PTMs related to RUVBL2 Antibody (NBP2-57593).

Research Areas for RUVBL2 Antibody (NBP2-57593)

Find related products by research area.

Blogs on RUVBL2

There are no specific blogs for RUVBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RUVBL2 Antibody and receive a gift card or discount.


Gene Symbol RUVBL2