RSU1 Antibody

Images

 
Western Blot: RSU1 Antibody [NBP1-54879] - Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry-Paraffin: RSU1 Antibody [NBP1-54879] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSU1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RSU1(Ras suppressor protein 1) The peptide sequence was selected from the C terminal of RSU1. Peptide sequence PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSU1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RSU1 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RSU1 Antibody

  • FLJ31034
  • ras suppressor protein 1 variant 1
  • ras suppressor protein 1 variant 2
  • Ras suppressor protein 1
  • RSP1
  • RSP-1ras suppressor protein 1 variant 3
  • rsu-1

Background

RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6257
Species: Hu, Mu, Rt
Applications: WB
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4798
Species: Hu, Mu
Applications: WB
NBL1-15617
Species: Hu
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47266
Species: Hu, Mu
Applications: WB, IP
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54879
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RSU1 Antibody (NBP1-54879) (0)

There are no publications for RSU1 Antibody (NBP1-54879).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSU1 Antibody (NBP1-54879) (0)

There are no reviews for RSU1 Antibody (NBP1-54879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RSU1 Antibody (NBP1-54879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSU1 Products

Bioinformatics Tool for RSU1 Antibody (NBP1-54879)

Discover related pathways, diseases and genes to RSU1 Antibody (NBP1-54879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSU1 Antibody (NBP1-54879)

Discover more about diseases related to RSU1 Antibody (NBP1-54879).
 

Pathways for RSU1 Antibody (NBP1-54879)

View related products by pathway.

Research Areas for RSU1 Antibody (NBP1-54879)

Find related products by research area.

Blogs on RSU1

There are no specific blogs for RSU1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSU1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSU1
Uniprot