RS1 Antibody - Azide and BSA Free

Western Blot: RS1 Antibody [H00006247-B01P] - Analysis of RS1 expression in transfected 293T cell line by RS1 polyclonal antibody. Lane 1: RS1 transfected lysate(24.64 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RS1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RS1 (AAI41639.1, 1 a.a. - 224 a.a.) full-length human protein. MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
• Specificity: Reacts with retinoschisis (X-linked, juvenile) 1.
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RS1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB. Use in Immunohistochemistry reported in scientific literature (PMID: 31174210).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31174210).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RS1 Antibody - Azide and BSA Free

• retinoschisin 1
• retinoschisis (X-linked, juvenile) 1
• RS
• XL
• X-linked juvenile retinoschisis protein
• XLRS1retinoschisin

Background

This gene encodes an extracellular protein that plays a crucial role in the cellular organization of the retina. The encoded protein is assembled and secreted from photoreceptors and bipolar cells as a homo-oligomeric protein complex. Mutations in this gene are responsible for X-linked retinoschisis, a common, early-onset macular degeneration in males that results in a splitting of the inner layers of the retina and severe loss in vision. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RS1 Antibody (H00006247-B01P)(2)

Publications using H00006247-B01P

• Zhang T, Cheng G, Chen P et al. RS1 gene is a novel prognostic biomarker for lung adenocarcinoma Thoracic Cancer 2022-06-01 [PMID: 35569920] (Immunohistochemistry, Mouse)
• Liu Y, Kinoshita J, Ivanova E et al. Mouse models of X-linked juvenile retinoschisis have an early onset phenotype, the severity of which varies with genotype Hum. Mol. Genet. 2019-06-07 [PMID: 31174210] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: RS1
• Entrez:
  • 6247(Human)
• Uniprot:
  • AAI41639.1(Human)