RRM2 Antibody (1E1.)

Images

 
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 monoclonal antibody (M01), clone 1E1. Analysis of RRM2 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 expression in HeLa NE ( Cat # L013V3 ).
Immunoprecipitation: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of RRM2 transfected lysate using anti-RRM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRM2 MaxPab rabbit polyclonal ...read more
ELISA: RRM2 Antibody (1E1.) [H00006241-M01] - RRM2 Antibody (1E1) [H00006241-M01] - Detection limit for recombinant GST tagged RRM2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
1E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RRM2 Antibody (1E1.) Summary

Immunogen
RRM2 (NP_001025, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Specificity
RRM2 - ribonucleotide reductase M2 polypeptide
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RRM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00006241-M01 in the following applications:

  • 1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RRM2 Antibody (1E1.)

  • EC 1.17.4.1
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2 polypeptide
  • ribonucleotide reductase M2
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M

Background

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB6979
Species: Hu
Applications: WB
NB100-64852
Species: Hu, Ca, Pm
Applications: Flow, IHC, IHC-Fr
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF1034
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for RRM2 Antibody (H00006241-M01)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 7 of 7.
Publications using H00006241-M01 Applications Species
Toompuu M, Karblane K, Pata P et al. ABCE1 is essential for S phase progression in human cells. Cell Cycle. 2016 Mar 17 [PMID: 26985706] (WB, Human) WB Human
Grossi F, Dal Bello MG, Salvi S et al. Expression of Ribonucleotide Reductase Subunit-2 and Thymidylate Synthase Correlates with Poor Prognosis in Patients with Resected Stages I-III Non-Small Cell Lung Cancer. Disease Markers. 2015 Oct 07 [PMID: 26663950] (IHC-P, Human)

Details:
RRM2 antibody was used at 1:10 dilution for IHC-P analysis of tumour samples from 82 consecutive patients with stages I–III non-small cell lung cancer/NSCLC. The assay implicated 3um sections, automatic immunostainer, antigen-retrieval with citrate buffer (pH 6) at 90C for 30 minutes, 1 hour 37C incubation and post primary processing with Ultraview Universal DAB Detection Kit.
IHC-P Human
Kim SH, Park ER, Joo HY et al. RRM1 maintains centrosomal integrity via CHK1 and CDK1 signaling during replication stress. Cancer Lett. 2014 Jan 14 [PMID: 24434653]
Anagnostou, V K, Dimou, A T, Botsis, T et al. Molecular classification of nonsmall cell lung cancer using a 4-protein quantitative assay Cancer 2012 [PMID: 22009769] (WB, Human) WB Human
Zhou J, Snyder A, Lieberman PM. Epstein-Barr virus episome stability is coupled to a delay in replication timing. J Virol. 2008 Dec 10. [PMID: 19073720]
Tang LY, Deng N, Wang LS et al. Quantitative phosphoproteome profiling of Wnt3a mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine-20 in canonical Wnt signal transduction. Mol Cell Proteomics;6(11):1952-67. 2007 Nov. [PMID: 17693683]
Anagnostou VK, Dimou AT, Botsis T et al. Molecular classification of nonsmall-cell lung cancer using a 4-protein quantitative assay. Cancer. 2011 Aug 2.

Reviews for RRM2 Antibody (H00006241-M01) (0)

There are no reviews for RRM2 Antibody (H00006241-M01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRM2 Antibody (H00006241-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RRM2 Antibody (1E1.) Products

Related Products by Gene

Bioinformatics Tool for RRM2 Antibody (H00006241-M01)

Discover related pathways, diseases and genes to RRM2 Antibody (H00006241-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRM2 Antibody (H00006241-M01)

Discover more about diseases related to RRM2 Antibody (H00006241-M01).
 

Pathways for RRM2 Antibody (H00006241-M01)

View related products by pathway.

PTMs for RRM2 Antibody (H00006241-M01)

Learn more about PTMs related to RRM2 Antibody (H00006241-M01).
 

Research Areas for RRM2 Antibody (H00006241-M01)

Find related products by research area.

Blogs on RRM2

There are no specific blogs for RRM2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRM2 Antibody (1E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RRM2
Entrez
OMIM
Uniprot

Customers Who Bought This Also Bought