RRAGC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RRAGC Antibody [NBP2-56218] - Staining of human cell line U-2 OS shows localization to nucleus & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RRAGC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RRAGC Antibody - BSA Free (NBP2-56218) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RRAGC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RRAGC Recombinant Protein Antigen (NBP2-56218PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RRAGC Antibody - BSA Free

• FLJ13311
• GTPase-interacting protein 2
• GTR2
• Rag C protein
• Rag C
• RAGC
• Ras-related GTP binding C
• ras-related GTP-binding protein C
• TIB929

Background

RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RRAGC