Novus Biologicals products are now on bio-techne.com

RPS4X Antibody - BSA Free

Images

 
Western Blot: RPS4X Antibody [NBP2-94118] - Western blot analysis of extracts of various cell lines, using RPS4X antibody (NBP2-94118) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RPS4X Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 66-263 of human RPS4X (NP_000998.1). MQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS4X
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:500
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RPS4X Antibody - BSA Free

  • CCG2Single copy abundant mRNA protein
  • DXS306
  • FLJ40595
  • ribosomal protein S4, X-linked
  • RPS4cell cycle gene 2
  • SCAR40S ribosomal protein S4, X isoform
  • SCR10ribosomal protein S4X isoform
  • single-copy abundant mRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF5514
Species: Hu, Mu
Applications: WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-94504
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RPS4X Antibody (NBP2-94118) (0)

There are no publications for RPS4X Antibody (NBP2-94118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS4X Antibody (NBP2-94118) (0)

There are no reviews for RPS4X Antibody (NBP2-94118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS4X Antibody (NBP2-94118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS4X Products

Array NBP2-94118

Research Areas for RPS4X Antibody (NBP2-94118)

Find related products by research area.

Blogs on RPS4X

There are no specific blogs for RPS4X, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS4X Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS4X