RPS4X Antibody

Images

 
Immunohistochemistry-Paraffin: RPS4X Antibody [NBP1-82761] - RPS4Y1 Antibody [NBP1-82761] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS4X Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS4X
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPS4X Recombinant Protein Antigen (NBP1-82761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS4X Antibody

  • CCG2Single copy abundant mRNA protein
  • DXS306
  • FLJ40595
  • ribosomal protein S4, X-linked
  • RPS4cell cycle gene 2
  • SCAR40S ribosomal protein S4, X isoform
  • SCR10ribosomal protein S4X isoform
  • single-copy abundant mRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF5514
Species: Hu, Mu
Applications: WB
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPS4X Antibody (NBP1-82761) (0)

There are no publications for RPS4X Antibody (NBP1-82761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS4X Antibody (NBP1-82761) (0)

There are no reviews for RPS4X Antibody (NBP1-82761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPS4X Antibody (NBP1-82761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS4X Products

Bioinformatics Tool for RPS4X Antibody (NBP1-82761)

Discover related pathways, diseases and genes to RPS4X Antibody (NBP1-82761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS4X Antibody (NBP1-82761)

Discover more about diseases related to RPS4X Antibody (NBP1-82761).
 

Pathways for RPS4X Antibody (NBP1-82761)

View related products by pathway.

PTMs for RPS4X Antibody (NBP1-82761)

Learn more about PTMs related to RPS4X Antibody (NBP1-82761).

Blogs on RPS4X

There are no specific blogs for RPS4X, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS4X Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS4X