RPL6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPL6 Antibody [NBP2-68765] - Staining of human cell line RH-30 shows localization to microtubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RPL6 Antibody

  • DNA-binding protein TAXREB107
  • Neoplasm-related protein C140
  • ribosomal protein L6,60S ribosomal protein L6
  • RPL6
  • SHUJUN-2
  • TaxREB107
  • Tax-responsive enhancer element-binding protein 107
  • TXREB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-80104
Species: Hu
Applications: WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RPL6 Antibody (NBP2-68765) (0)

There are no publications for RPL6 Antibody (NBP2-68765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL6 Antibody (NBP2-68765) (0)

There are no reviews for RPL6 Antibody (NBP2-68765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL6 Antibody (NBP2-68765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL6 Products

Bioinformatics Tool for RPL6 Antibody (NBP2-68765)

Discover related pathways, diseases and genes to RPL6 Antibody (NBP2-68765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL6 Antibody (NBP2-68765)

Discover more about diseases related to RPL6 Antibody (NBP2-68765).
 

Pathways for RPL6 Antibody (NBP2-68765)

View related products by pathway.

Blogs on RPL6

There are no specific blogs for RPL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL6