Home » RPL6 » RPL6 Antibodies » RPL6 Antibody

RPL6 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RPL6 Antibody [NBP2-68765] - Staining of human cell line RH-30 shows localization to microtubules.
Immunocytochemistry/ Immunofluorescence: RPL6 Antibody [NBP2-68765] - Staining of human cell line RH-30 shows localization to microtubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RPL6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RPL6 Antibody

  • DNA-binding protein TAXREB107
  • Neoplasm-related protein C140
  • ribosomal protein L6,60S ribosomal protein L6
  • RPL6
  • SHUJUN-2
  • TaxREB107
  • Tax-responsive enhancer element-binding protein 107
  • TXREB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
RPL5 Antibody
NBP1-31413
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Knockdown Validated: RPL5 Antibody [NBP1-31413] - Western Blot analysis of RPL5 protein expressions in CD71highTer119high cells. There was a significant decrease in the expression level of RPL5 in the treated shRNA Rpl5 compared to the control mice. Image collected and cropped by CiteAb from the following publication (www.discoveriesjournals.org/discoveries/D.2019.03.DI-Kazerounian-Beggs.DOI) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Mouse hind brain. RPL5 antibody diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
RPL4 Antibody (4A3)
H00006124-M01
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3 Analysis of RPL4 expression in K-562.
Immunocytochemistry/Immunofluorescence: RPL4 Antibody (4A3) [H00006124-M01] - Analysis of monoclonal antibody to RPL4 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RPL4 Antibody (4A3) [H00006124-M01] - Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
FAM60A Antibody
H00058516-B02P
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(8 Reviews)
(176 Publications)
Species: Hu
Applications: BA
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Flow Cytometry: Glut1 Antibody [NB110-39113] - An intracellular stain was performed on HepG2 with NB110-39113 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut1 Antibody [NB110-39113] - PrP-mediated increase in IC iron downregulates glucose transporters in the brain, neuroretina, and the liver: A similar evaluation of retinal lysates shows upregulation of Glut1 in PrP-/- relative to Tg40 PrP samples (lanes 1 & 3). Iron overloading downregulates Glut1 in Tg40 PrP samples relative to untreated controls, but has minimal effect on similarly treated PrP-/- samples (lanes 2 & 4). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/s41598-018-24786-1) licensed under a CC-BY licence.
(7 Reviews)
(48 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
IRS1 Antibody
(OTI3G10)
NBP2-45435
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RPL3 Antibody
NBP2-20214
Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - 4T1 xenograft, using RPL3 antibody at 1:500 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PPFIBP1 Antibody
NBP1-83192
Immunohistochemistry-Paraffin: PPFIBP1 Antibody [NBP1-83192] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
Immunocytochemistry/Immunofluorescence: PPFIBP1 Antibody [NBP1-83192] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Western Blot: PPFIBP1 Antibody [NBP1-83192] - Analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, WB
ZACN Antibody
NBP1-80104
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
RPL7 Antibody
NB100-2269
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: RPL7 Antibody [NB100-2269] - Detection of human and mouse RPL7 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TMCK-1, and mouse NIH 3T3 cells prepared using RIPA lysis buffer. Antibody: Affinity purified rabbit anti-RPL7 antibody NB100-2269 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Neuropeptide B
Antibody
NBP3-05567
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of HeLa cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of NIH/3T3 cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Neuropeptide B Antibody [NBP3-05567] - Western blot analysis of extracts of various cell lines, using Neuropeptide B antibody (NBP3-05567) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Species: Hu, Mu
Applications: ICC/IF, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500. Image submitted by a verified customer review.
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RPL6 Antibody (NBP2-68765) (0)

There are no publications for RPL6 Antibody (NBP2-68765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL6 Antibody (NBP2-68765) (0)

There are no reviews for RPL6 Antibody (NBP2-68765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL6 Antibody (NBP2-68765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL6 Products

Bioinformatics Tool for RPL6 Antibody (NBP2-68765)

Discover related pathways, diseases and genes to RPL6 Antibody (NBP2-68765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL6 Antibody (NBP2-68765)

Discover more about diseases related to RPL6 Antibody (NBP2-68765).
 

Pathways for RPL6 Antibody (NBP2-68765)

View related products by pathway.

Blogs on RPL6

There are no specific blogs for RPL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL6 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RPL6