RPL32 Antibody

Images

 
Western Blot: RPL32 Antibody [NBP1-80442] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL32 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human RPL32. Peptide sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL32
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RPL32 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL32 Antibody

  • M
  • ribosomal protein L32,60S ribosomal protein L32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-82855
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80025
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94135
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38971
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DGAL30
Species: Hu
Applications: ELISA
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-20212
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-93661
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-57476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006143-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-93788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80442
Species: Hu
Applications: WB

Publications for RPL32 Antibody (NBP1-80442) (0)

There are no publications for RPL32 Antibody (NBP1-80442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL32 Antibody (NBP1-80442) (0)

There are no reviews for RPL32 Antibody (NBP1-80442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL32 Antibody (NBP1-80442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL32 Products

Bioinformatics Tool for RPL32 Antibody (NBP1-80442)

Discover related pathways, diseases and genes to RPL32 Antibody (NBP1-80442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL32 Antibody (NBP1-80442)

Discover more about diseases related to RPL32 Antibody (NBP1-80442).
 

Pathways for RPL32 Antibody (NBP1-80442)

View related products by pathway.

PTMs for RPL32 Antibody (NBP1-80442)

Learn more about PTMs related to RPL32 Antibody (NBP1-80442).

Blogs on RPL32

There are no specific blogs for RPL32, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL32
Uniprot