RPL13 Antibody - BSA Free

Western Blot: RPL13 Antibody [NBP2-13250] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: RPL13 Antibody [NBP2-13250] - Staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RPL13 Antibody [NBP2-13250] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell line NB4.

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPL13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPL13 Antibody - BSA Free (NBP2-13250) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPL13 Protein (NBP2-13250PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPL13 Antibody - BSA Free

• BBC1FLJ27454
• Breast basic conserved protein 1
• D16S444E
• FLJ27453
• MGC117342
• MGC71373,60S ribosomal protein L13
• OK/SW-cl.46
• ribosomal protein L13

Background

RPL13, also known as 60S ribosomal protein L13, is a 24kDa 211 amino acid protein with a shorter 19kDA 164 isoform produced by alternative splicing. RPL13 belongs to the L13E family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on RPL13 in relation to Smith-Magenis syndrome, Treacher Collins syndrome, breast carcinoma, carcinoma, skin atrophy, prostate cancer, prostatitis, schizophrenia and malaria. RPL13 has been linked to the reverse transcription, ribosome assembly, cell division, DNA protection and pigmentation pathways where it interacts with RPL4, RPL8, RPS3, SMN1 and RPL12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL13