RPS16 Antibody

Images

 
Western Blot: RPS16 Antibody [NBP1-80025] - Sample Tissue: Jurkat cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/ml, Peptide Concentration: ...read more
Immunohistochemistry: RPS16 Antibody [NBP1-80025] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: RPS16 Antibody [NBP1-80025] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: RPS16 Antibody [NBP1-80025] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS16 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human RPS16. Peptide sequence SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS16
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RPS16 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPS16 Antibody

  • ribosomal protein S16,40S ribosomal protein S16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75649
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-33717
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006218-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80804
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93632
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006202-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP2-67301
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB

Publications for RPS16 Antibody (NBP1-80025) (0)

There are no publications for RPS16 Antibody (NBP1-80025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS16 Antibody (NBP1-80025) (0)

There are no reviews for RPS16 Antibody (NBP1-80025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS16 Antibody (NBP1-80025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS16 Products

Bioinformatics Tool for RPS16 Antibody (NBP1-80025)

Discover related pathways, diseases and genes to RPS16 Antibody (NBP1-80025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS16 Antibody (NBP1-80025)

Discover more about diseases related to RPS16 Antibody (NBP1-80025).
 

Pathways for RPS16 Antibody (NBP1-80025)

View related products by pathway.

PTMs for RPS16 Antibody (NBP1-80025)

Learn more about PTMs related to RPS16 Antibody (NBP1-80025).
 

Research Areas for RPS16 Antibody (NBP1-80025)

Find related products by research area.

Blogs on RPS16

There are no specific blogs for RPS16, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS16
Uniprot