RPL21 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RPL21 Antibody [NBP2-13252] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center, cytosol & endoplasmic reticulum.

Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human Lymph node shows strong membranous and cytoplasmic positivity in germinal center and non-germinal center cells.

Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human Colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPL21 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPL21 Protein (NBP2-13252PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPL21 Antibody - BSA Free

• DKFZp686C06101
• FLJ27458
• L21,60S ribosomal protein L21
• MGC104274
• MGC104275
• MGC71252
• ribosomal protein L21

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L21E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL21