RNF135 Antibody

Images

 
Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target: RNF135. Positive control (+): Human Placenta (PL). Negative control (-): HeLa (HL). Antibody concentration: 1ug/ml
Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target Name: RNF135. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: RNF135 Antibody [NBP2-88163] - WB Suggested Anti-RNF135 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate
Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target Name: RNF135. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 3ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF135 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNF135. Peptide sequence: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RNF135
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF135 Antibody

  • E3 ubiquitin-protein ligase RNF135
  • EC 6.3.2.-
  • MGC13061
  • REUL
  • ring finger protein 135RIG-I E3 ubiquitin ligase
  • Riplet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-97838
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-06069
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP1-57476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RNF135 Antibody (NBP2-88163) (0)

There are no publications for RNF135 Antibody (NBP2-88163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF135 Antibody (NBP2-88163) (0)

There are no reviews for RNF135 Antibody (NBP2-88163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF135 Antibody (NBP2-88163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF135 Products

Bioinformatics Tool for RNF135 Antibody (NBP2-88163)

Discover related pathways, diseases and genes to RNF135 Antibody (NBP2-88163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF135 Antibody (NBP2-88163)

Discover more about diseases related to RNF135 Antibody (NBP2-88163).
 

Pathways for RNF135 Antibody (NBP2-88163)

View related products by pathway.

PTMs for RNF135 Antibody (NBP2-88163)

Learn more about PTMs related to RNF135 Antibody (NBP2-88163).
 

Research Areas for RNF135 Antibody (NBP2-88163)

Find related products by research area.

Blogs on RNF135

There are no specific blogs for RNF135, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF135 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF135