RPL10A Antibody - BSA Free

Western Blot: RPL10A Antibody [NBP2-93591] - Western blot analysis of extracts of various cell lines, using RPL10A antibody (A5925) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: RPL10A Antibody [NBP2-93591] - Immunofluorescence analysis of C6 cells using RPL10A Rabbit pAb (A5925) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: RPL10A Antibody [NBP2-93591] - Immunohistochemistry of paraffin-embedded rat cerebellum using RPL10A Rabbit pAb (A5925) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: RPL10A Antibody [NBP2-93591] - Immunohistochemistry of paraffin-embedded mouse brain using RPL10A Rabbit pAb (A5925) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPL10A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPL10A Antibody - BSA Free (NBP2-93591) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RPL10A (NP_009035.3). MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL10A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPL10A Antibody - BSA Free

• CSA-19
• Csa-19,60S ribosomal protein L10a
• NEDD6
• NEDD-6
• Neural precursor cell expressed developmentally down-regulated protein 6
• ribosomal protein L10a

Background

RPL10A, also known as Ribosomal Protein L10a, is a 25kDa 217 amino acid protein that belongs to the L1P family of ribosomal proteins. Current research is being conducted on RPL10A in relation to the diseases Diamond-Blackfan anemia, Treacher Collins syndrome, metastasis efficiency, anemia and malaria. RPL10A has been linked to the virulence, nuclear export, translation, vitellogenesis, cell development and histone deacetylation where it interacts with RPL26, RPL6, RPL8, RPS3 and RPL11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL10A