RPL10A Antibody - BSA Free

Western Blot: RPL10A Antibody [NBP1-56386] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPL10A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RPL10A (ribosomal protein L10a) The peptide sequence was selected from the N terminal of RPL10A)(50ug). Peptide sequence MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL10A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPL10A Antibody - BSA Free

• CSA-19
• Csa-19,60S ribosomal protein L10a
• NEDD6
• NEDD-6
• Neural precursor cell expressed developmentally down-regulated protein 6
• ribosomal protein L10a

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. This gene previously was referred to as NEDD6 (neural precursor cell expressed, developmentally downregulated 6), but it has been renamed RPL10A (ribosomal protein 10a). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL10A
• Uniprot:
  • P62906(Human)