RPH3AL Antibody

Western Blot: RPH3AL Antibody [NBP2-83465] - Host: Rabbit. Target Name: RPH3AL. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPH3AL Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPH3AL. Peptide sequence: RIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPH3AL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPH3AL Antibody

• Noc2
• NOC2No C2 domains protein
• rab effector Noc2
• rabphilin 3A-like (without C2 domains)
• Rabphilin-3A-like protein

Background

Rab GTPase effector involved in the late steps of regulated exocytosis, both in endocrine and exocrine cells . Acts as a potential RAB3B effector protein in epithelial cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPH3AL