RPAIN Antibody


Western Blot: RPAIN Antibody [NBP1-81706] - Analysis in control (vector only transfected HEK293T lysate) and RPAIN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RPAIN Antibody [NBP1-81706] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: RPAIN Antibody [NBP1-81706] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RPAIN Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
Specificity of human RPAIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPAIN Protein (NBP1-81706PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RPAIN Antibody

  • FLJ25625
  • FLJ30490
  • FLJ42429
  • hRIP
  • MGC4189
  • nuclear transporter
  • RAP interaction protein
  • RPA interacting protein
  • RPA-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, GS, KD, KO
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPAIN Antibody (NBP1-81706) (0)

There are no publications for RPAIN Antibody (NBP1-81706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPAIN Antibody (NBP1-81706) (0)

There are no reviews for RPAIN Antibody (NBP1-81706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPAIN Antibody (NBP1-81706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RPAIN Products

Bioinformatics Tool for RPAIN Antibody (NBP1-81706)

Discover related pathways, diseases and genes to RPAIN Antibody (NBP1-81706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPAIN Antibody (NBP1-81706)

Discover more about diseases related to RPAIN Antibody (NBP1-81706).

Pathways for RPAIN Antibody (NBP1-81706)

View related products by pathway.

Blogs on RPAIN

There are no specific blogs for RPAIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPAIN Antibody and receive a gift card or discount.


Gene Symbol RPAIN