RP5-1077B9.4 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 279-388 of human RP5-1077B9.4 (NP_068752.2). AHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MIIP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RP5-1077B9.4 Antibody - Azide and BSA Free
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for RP5-1077B9.4 Antibody (NBP3-03632) (0)
There are no publications for RP5-1077B9.4 Antibody (NBP3-03632).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RP5-1077B9.4 Antibody (NBP3-03632) (0)
There are no reviews for RP5-1077B9.4 Antibody (NBP3-03632).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RP5-1077B9.4 Antibody (NBP3-03632) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RP5-1077B9.4 Products
Research Areas for RP5-1077B9.4 Antibody (NBP3-03632)
Find related products by research area.
|
Blogs on RP5-1077B9.4