RP5-1077B9.4 Antibody

Images

 
Western Blot: RP5-1077B9.4 Antibody [NBP1-87394] - Analysis in control (vector only transfected HEK293T lysate) and mIIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RP5-1077B9.4 Antibody [NBP1-87394] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RP5-1077B9.4 Antibody [NBP1-87394] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: RP5-1077B9.4 Antibody [NBP1-87394] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RP5-1077B9.4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RP5-1077B9.4 Protein (NBP1-87394PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RP5-1077B9.4 Antibody

  • FLJ12438
  • FLJ38609
  • IGFBP-2-Binding Protein
  • IGFBP2-binding protein
  • IIp45
  • invasion inhibitory protein 45
  • Invasion-inhibitory protein 45
  • migration and invasion inhibitory protein
  • migration and invasion-inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF674
Species: Hu
Applications: WB, Simple Western, Neut
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88074
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87394
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RP5-1077B9.4 Antibody (NBP1-87394) (0)

There are no publications for RP5-1077B9.4 Antibody (NBP1-87394).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RP5-1077B9.4 Antibody (NBP1-87394) (0)

There are no reviews for RP5-1077B9.4 Antibody (NBP1-87394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RP5-1077B9.4 Antibody (NBP1-87394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RP5-1077B9.4 Products

Bioinformatics Tool for RP5-1077B9.4 Antibody (NBP1-87394)

Discover related pathways, diseases and genes to RP5-1077B9.4 Antibody (NBP1-87394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RP5-1077B9.4 Antibody (NBP1-87394)

Discover more about diseases related to RP5-1077B9.4 Antibody (NBP1-87394).
 

Pathways for RP5-1077B9.4 Antibody (NBP1-87394)

View related products by pathway.

PTMs for RP5-1077B9.4 Antibody (NBP1-87394)

Learn more about PTMs related to RP5-1077B9.4 Antibody (NBP1-87394).

Blogs on RP5-1077B9.4

There are no specific blogs for RP5-1077B9.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RP5-1077B9.4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIIP