Recombinant Human ROPN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ROPN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-120 of Human ROPN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Protein/Peptide Type
Recombinant Protein
Gene
ROPN1

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ROPN1 Protein

  • Cancer/testis antigen 91
  • CT91Rhophilin-associated protein 1A
  • ODF6RHPNAP1
  • outer dense fiber of sperm tails 6
  • rhophilin associated tail protein 1
  • ROPN1ADKFZp434B1222
  • ropporin
  • ropporin, rhophilin associated protein 1
  • ropporin-1A

Background

ROPN1( AAH15413, 1 a.a. - 121 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89173
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-82881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00054763-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ROPN1 Recombinant Protein (H00054763-P01) (0)

There are no publications for ROPN1 Recombinant Protein (H00054763-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROPN1 Recombinant Protein (H00054763-P01) (0)

There are no reviews for ROPN1 Recombinant Protein (H00054763-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROPN1 Recombinant Protein (H00054763-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROPN1 Products

Bioinformatics Tool for ROPN1 Recombinant Protein (H00054763-P01)

Discover related pathways, diseases and genes to ROPN1 Recombinant Protein (H00054763-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROPN1 Recombinant Protein (H00054763-P01)

Discover more about diseases related to ROPN1 Recombinant Protein (H00054763-P01).
 

Pathways for ROPN1 Recombinant Protein (H00054763-P01)

View related products by pathway.

PTMs for ROPN1 Recombinant Protein (H00054763-P01)

Learn more about PTMs related to ROPN1 Recombinant Protein (H00054763-P01).

Blogs on ROPN1

There are no specific blogs for ROPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818
ROPN1 Antibody
21050002-0.1mg
ASPM Antibody
NB100-2278

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ROPN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ROPN1