ROCK2 Antibody (2A4)

Images

 
Western Blot: ROCK2 Antibody (2A4) [H00009475-M01] - ROCK2 monoclonal antibody (M01), clone 2A4 Analysis of ROCK2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: ROCK2 Antibody (2A4) [H00009475-M01] - Analysis of monoclonal antibody to ROCK2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ROCK2 Antibody (2A4) Summary

Immunogen
ROCK2 (NP_004841, 1279 a.a. ~ 1389 a.a) partial recombinant protein with GST tag.KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSS PRTSMKIQQNQSIRRPSRQLAPNKPS
Localization
Cytoplasmic, and associated with actin microfilaments and the plasma membrane.
Specificity
ROCK2 - Rho-associated, coiled-coil containing protein kinase 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ROCK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ROCK2 Antibody (2A4)

  • coiled-coil-containing protein kinase 2
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0619
  • p164 ROCK-2
  • Rho kinase 2
  • rho-associated protein kinase 2
  • Rho-associated, coiled-coil containing protein kinase 2
  • ROCK2
  • ROCK-II
  • ROKalpha

Background

The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ROCK2 Antibody (H00009475-M01) (0)

There are no publications for ROCK2 Antibody (H00009475-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROCK2 Antibody (H00009475-M01) (0)

There are no reviews for ROCK2 Antibody (H00009475-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ROCK2 Antibody (H00009475-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROCK2 Products

Bioinformatics Tool for ROCK2 Antibody (H00009475-M01)

Discover related pathways, diseases and genes to ROCK2 Antibody (H00009475-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROCK2 Antibody (H00009475-M01)

Discover more about diseases related to ROCK2 Antibody (H00009475-M01).
 

Pathways for ROCK2 Antibody (H00009475-M01)

View related products by pathway.

PTMs for ROCK2 Antibody (H00009475-M01)

Learn more about PTMs related to ROCK2 Antibody (H00009475-M01).
 

Research Areas for ROCK2 Antibody (H00009475-M01)

Find related products by research area.

Blogs on ROCK2

There are no specific blogs for ROCK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROCK2 Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ROCK2
Entrez
OMIM
Uniprot