ROCK1 Antibody

Images

 
Immunohistochemistry-Paraffin: ROCK1 Antibody [NBP2-13244] Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROCK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEDLICPCKVSYDVTSARDMLLLACSQDEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROCK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ROCK1 Protein (NBP2-13244PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ROCK1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • MGC131603
  • MGC43611
  • p160 ROCK-1
  • p160ROCK
  • p160-ROCK
  • PRO0435
  • Renal carcinoma antigen NY-REN-35
  • Rho kinase
  • rho-associated protein kinase 1
  • Rho-associated, coiled-coil containing protein kinase 1
  • Rho-associated, coiled-coil-containing protein kinase 1
  • ROCK1
  • ROK beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ROCK1 Antibody (NBP2-13244) (0)

There are no publications for ROCK1 Antibody (NBP2-13244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROCK1 Antibody (NBP2-13244) (0)

There are no reviews for ROCK1 Antibody (NBP2-13244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ROCK1 Antibody (NBP2-13244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROCK1 Products

Bioinformatics Tool for ROCK1 Antibody (NBP2-13244)

Discover related pathways, diseases and genes to ROCK1 Antibody (NBP2-13244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROCK1 Antibody (NBP2-13244)

Discover more about diseases related to ROCK1 Antibody (NBP2-13244).
 

Pathways for ROCK1 Antibody (NBP2-13244)

View related products by pathway.

PTMs for ROCK1 Antibody (NBP2-13244)

Learn more about PTMs related to ROCK1 Antibody (NBP2-13244).
 

Research Areas for ROCK1 Antibody (NBP2-13244)

Find related products by research area.

Blogs on ROCK1.

A good helper on validating your FLOW and IHC data - Rabbit IgG Isotype Control
Isotype controls are primarily used as negative controls in flow cytometry but they can also be used for immunohistochemistry. They are used to approximate the non-specific target primary antibody binding due to protein-protein interactions, binding t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROCK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ROCK1
Entrez