ROCK1 Antibody - BSA Free

Western Blot: ROCK1 Antibody [NBP1-82450] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ROCK1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: ROCK1 Antibody [NBP1-82450] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Western Blot: ROCK1 Antibody [NBP1-82450] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Western Blot: ROCK1 Antibody [NBP1-82450] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ROCK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ROCK1 Antibody - BSA Free (NBP1-82450) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ROCK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ROCK1 Protein (NBP1-82450PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ROCK1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• MGC131603
• MGC43611
• p160 ROCK-1
• p160ROCK
• p160-ROCK
• PRO0435
• Renal carcinoma antigen NY-REN-35
• Rho kinase
• rho-associated protein kinase 1
• Rho-associated, coiled-coil containing protein kinase 1
• Rho-associated, coiled-coil-containing protein kinase 1
• ROCK1
• ROK beta

Background

Rho-associated kinase I (ROCK1, ROK beta, p160ROCK) is a serine-threonine protein kinase and an effector of the small GTPase Rho. With N-terminus protein kinase domain and C-terminus Rho-binding domain/pleckstrin homology domain, ROCK1 can be activated by either RhoA or RhoB. In Rho specific ROCK1 activation, a Rho protein binds to the Rho-binding domain and induces a conformational change which opens the kinase domain for the phosphorylation of downstream effectors (1). Activated ROCK1 phosphorylates various signaling proteins, such as myosin light chain phosphatase, LIM kinases, and ezrin-radixin-moesin proteins. Caspase-3 also activates ROCK1; Caspase-3 cleaves ROCK1 at DETD1113/G sequence and removes its inhibitory c-terminal domain. This activation, independent of Rho activity, leads to apoptotic membrane blebbing (2). ROCK1 is involved in regulating actin cytoskeleton assembly, cell migration, centromere positing, smooth muscle contraction, and neurite outgrowth. Its involvement in tumor invasion, hypertension, and bronchial asthma makes ROCK1 an ideal target for drug development (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ROCK1