RNF98 Antibody

Images

 
Western Blot: RNF98 Antibody [NBP1-54924] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF98 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRIM36 and was validated on Western blot.
Theoretical MW
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF98 Antibody

  • E3 ubiquitin-protein ligase TRIM36
  • EC 6.3.2.-
  • RBCC728RNF98HAPRIN
  • RING finger protein 98
  • tripartite motif containing 36
  • tripartite motif protein 36
  • tripartite motif-containing 36
  • Tripartite motif-containing protein 36
  • Zinc-binding protein Rbcc728

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00005229-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-78264
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
1073-BP/CF
Species: Hu
NBP2-56333
Species: Hu
Applications: WB, ICC/IF
NBP2-03794
Species: Hu, Mk
Applications: WB, Flow, ICC/IF

Publications for RNF98 Antibody (NBP1-54924) (0)

There are no publications for RNF98 Antibody (NBP1-54924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF98 Antibody (NBP1-54924) (0)

There are no reviews for RNF98 Antibody (NBP1-54924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF98 Antibody (NBP1-54924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF98 Products

Bioinformatics Tool for RNF98 Antibody (NBP1-54924)

Discover related pathways, diseases and genes to RNF98 Antibody (NBP1-54924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF98 Antibody (NBP1-54924)

Discover more about diseases related to RNF98 Antibody (NBP1-54924).
 

Pathways for RNF98 Antibody (NBP1-54924)

View related products by pathway.

Research Areas for RNF98 Antibody (NBP1-54924)

Find related products by research area.

Blogs on RNF98

There are no specific blogs for RNF98, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF98 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM36
Uniprot