RNF8 Antibody - Azide and BSA Free

Western Blot: RNF8 Antibody [H00009025-D01P] - Analysis of RNF8 expression in transfected 293T cell line by RNF8 polyclonal antibody.Lane 1: RNF8 transfected lysate(55.50 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF8 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RNF8 (NP_003949.1, 1 a.a. - 485 a.a.) full-length human protein. MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF8
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF8 Antibody - Azide and BSA Free

• ActA Binding Protein 2
• C3HC4-type zinc finger protein
• EC 6.3.2
• EC 6.3.2.-
• FLJ12013
• KIAA0646UBC13/UEV-interacting ring finger protein
• ring finger protein (C3HC4 type) 8
• ring finger protein 8E3 ubiquitin-protein ligase RNF8
• RNF8

Background

RNF8 is encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF8 Antibody (H00009025-D01P)(1)

Publication using H00009025-D01P

• M Deng, J Lin, S Nowsheen, T Liu, Y Zhao, PW Villalta, D Sicard, DJ Tschumperl, S Lee, J Kim, Z Lou Extracellular matrix stiffness determines DNA repair efficiency and cellular sensitivity to genotoxic agents Science Advances, 2020-09-11;6(37):. 2020-09-11 [PMID: 32917705]

Bioinformatics

• Gene Symbol: RNF8
• Uniprot:
  • NP_003949.1(Human)