RNF41 Antibody

Images

 
Western Blot: RNF41 Antibody [NBP1-87087] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RNF41 Antibody [NBP1-87087] - Staining of human cell line SiHa shows localization to nucleus, nuclear bodies & midbody ring.
Immunohistochemistry-Paraffin: RNF41 Antibody [NBP1-87087] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF41 Protein (NBP1-87087PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF41 Antibody

  • E3 ubiquitin-protein ligase NRDP1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLRF
  • MGC45228
  • NRDP1
  • ring finger protein 41neuregulin receptor degradation protein-1
  • SBBI03

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
AF7735
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF6008
Species: Hu, Mu, Rt
Applications: WB

Publications for RNF41 Antibody (NBP1-87087) (0)

There are no publications for RNF41 Antibody (NBP1-87087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF41 Antibody (NBP1-87087) (0)

There are no reviews for RNF41 Antibody (NBP1-87087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF41 Antibody (NBP1-87087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF41 Products

Bioinformatics Tool for RNF41 Antibody (NBP1-87087)

Discover related pathways, diseases and genes to RNF41 Antibody (NBP1-87087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF41 Antibody (NBP1-87087)

Discover more about diseases related to RNF41 Antibody (NBP1-87087).
 

Pathways for RNF41 Antibody (NBP1-87087)

View related products by pathway.

PTMs for RNF41 Antibody (NBP1-87087)

Learn more about PTMs related to RNF41 Antibody (NBP1-87087).
 

Research Areas for RNF41 Antibody (NBP1-87087)

Find related products by research area.

Blogs on RNF41

There are no specific blogs for RNF41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF41
Entrez
Uniprot