RNF25 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RNF25 Antibody - BSA Free (NBP2-32664) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RNF25 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for RNF25 Antibody - BSA Free
Background
RING finger protein 25 (RNF25, also named AO7) contains a RING finger domain and is ubiquitously expressed in various tissues. RNF25 was initially identified in a yeast two-hybrid screen of a murine T-cell library by using UbcH5b, an E2 enzyme, as bait. RNF25 has also been shown to act as a putative E3 ligase, at least in vitro. RNF25 localizes predominantly in the nucleus and supports the transcriptional activity of NF-kB by interacting with p65 in vivo upon stimulation with TNF. Yeast two-hybrid data also suggest that RNF25 interacts with a number of other molecules which may be potential ubiquitin ligase substrates. Among these are molecules that have critical roles in signal transduction and in regulation of translation (personal communication, Allan Weissman, CCR-NCI, Bethesda, MD).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Dr, Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for RNF25 Antibody (NBP2-32664) (0)
There are no publications for RNF25 Antibody (NBP2-32664).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RNF25 Antibody (NBP2-32664) (0)
There are no reviews for RNF25 Antibody (NBP2-32664).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RNF25 Antibody (NBP2-32664) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RNF25 Products
Research Areas for RNF25 Antibody (NBP2-32664)
Find related products by research area.
|
Blogs on RNF25