NKD2 Antibody


Western Blot: NKD2 Antibody [NBP2-13658] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NKD2 Antibody [NBP2-13658] - Staining of human kidney shows strong cytoplasmic positivity in subset of tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NKD2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQR HE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:2500 - 1:5000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKD2 Protein (NBP2-13658PEP)
Read Publication using
NBP2-13658 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NKD2 Antibody

  • Dvl-binding protein NKD2
  • hNkd2
  • naked cuticle homolog 2 (Drosophila)
  • naked cuticle-2
  • Naked2
  • naked-2
  • protein naked cuticle homolog 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt, Pm
Applications: WB
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
Species: Mu
Species: Hu
Applications: WB, IHC

Publications for NKD2 Antibody (NBP2-13658)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NKD2 Antibody (NBP2-13658) (0)

There are no reviews for NKD2 Antibody (NBP2-13658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKD2 Antibody (NBP2-13658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NKD2 Products

Bioinformatics Tool for NKD2 Antibody (NBP2-13658)

Discover related pathways, diseases and genes to NKD2 Antibody (NBP2-13658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKD2 Antibody (NBP2-13658)

Discover more about diseases related to NKD2 Antibody (NBP2-13658).

Pathways for NKD2 Antibody (NBP2-13658)

View related products by pathway.

PTMs for NKD2 Antibody (NBP2-13658)

Learn more about PTMs related to NKD2 Antibody (NBP2-13658).

Research Areas for NKD2 Antibody (NBP2-13658)

Find related products by research area.

Blogs on NKD2

There are no specific blogs for NKD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NKD2 Antibody and receive a gift card or discount.


Gene Symbol NKD2