NKD2 Antibody

Immunohistochemistry-Paraffin: NKD2 Antibody [NBP2-13658] - Staining of human kidney shows strong cytoplasmic positivity in subset of tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NKD2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NKD2 Protein (NBP2-13658PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NKD2 Antibody

• Dvl-binding protein NKD2
• hNkd2
• naked cuticle homolog 2 (Drosophila)
• naked cuticle-2
• Naked2
• naked-2
• protein naked cuticle homolog 2

Background

In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NKD2 Antibody (NBP2-13658)(2)

Publications using NBP2-13658

• Patel JR, Joel MZ, Lee KK et al. Single-cell RNA sequencing reveals dysregulated fibroblast subclusters in prurigo nodularis bioRxiv : the preprint server for biology 2023-02-03 [PMID: 36778229] (IHC-P, Human)
• Cao B, Yang W, Jin Y et al. Silencing NKD2 by promoter region hypermethylation promotes esophageal cancer progression by activating Wnt signaling J Thorac Oncol 2016-06-30 [PMID: 27374455] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: NKD2