RNF207 Antibody - BSA Free

Immunohistochemistry-Paraffin: RNF207 Antibody [NBP1-88495] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF207 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVDEQSESLQNTHDDSRNNAASARNNPGSVPEKREKTSEPKGNSWAPNGLSEEPLLKNMDHHRSKQKNGGDVPTWREHP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF207
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RNF207 Protein (NBP1-88495PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF207 Antibody - BSA Free

• C1orf188
• chromosome 1 open reading frame 188
• FLJ32096
• FLJ46380
• FLJ46593
• ring finger protein 207

Background

The RNF207 gene encodes a RING finger protein 207 that exists in four isoforms: isoform 1: 634 amino acids in length, 70 kDA; isoform 2: 244 amino acids long, nearly 26 kDA; isoform 3: 144 amino acids long, 15 kDA; and isoform 4: 292 amino acids long, 32 kDA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF207